General Information of This Photoreceptor (PR)
PR ID PR00006
PR Name Photolyase homology region of Arabidopsis Cryptochromes 2 (CRY2PHR)
Source of Species Arabidopsis thalino
Class Cryptochromes
UniProt ID Q96524
GenBank NP_849588
PDB ID 6X24
Sequence
MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSL
AHLSQSLKALGSDLTLIQTHNTISAILDCIRVTGPTKVVFNHLYDPVSLVRDHTVKEKLV
ERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVMLPPPEEEGQFYPG
RWRLMPITAAAEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLI
DYAKNSKKVVGNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLRG
IGLREYSRYICFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWA
TGWMHNRIRVIVSSFGVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHEL
DRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKP
IVDIDTARELLAKAISRTREAQIMIGAA
Components Photoreceptor Photolyase homology region of Arabidopsis Cryptochromes 2 (CRY2PHR)
Complementary Protein Cryptochrome-interacting basic-helix-loop-helix 1 (CIB1/CIBN)
Detail Info
Cofactor Flavin adenine dinucleotide (FAD)
Detail Info
3D Structure
Click to Save PDB File
Complementary Protein Detail of This PR
Complementary Protein Cryptochrome-interacting basic-helix-loop-helix 1 (CIB1/CIBN)
UniProt ID A0A061DZ54
Sequence
MNRALPEMLQCSDMTVLERQRARLKWQQEQLQQQQLQQQEQQQSYFSELSGVFSSQPSHV
EGFQGGLMSGDSVLGDMVMTRQLKPDPGLETAWPELVKVDMPGMGFGPCGYGNGPSFDMN
YAISRTSSCPPAVAAAVAGEVVEVKGKESVVSEKIGSAVGRESFKKRKVDKLQNLKVVAE
DDSKRIKACAEEGESKITGPNTNKSSSNNNNNKKESSTDTSKENSKVSEVQKPDYIHVRA
RRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVEF
LSMKLAAVNPRLDFNVENLFAKEVFPSCTTNFPTVGMSSEMANPPYLQVSPVQHVVSCCG
LEMGMNTPDMAPRRTISAPVSIPDASFLDSSCFPQIQPSATWDVELQNLYNVAFDQGRST
SFPSQPFTGSIEASNLKMEM
Cofactor Detail of This PR
Cofactor Name Flavin adenine dinucleotide (FAD)
PubChem CID 643975
Structure
Formula C27H33N9O15P2
Molecular Weight 785.5
Optogenetic System (OS) Consisting of This PR
OS00008
OS Info
OS Name: Cofilin-actin interaction optocontroled regulated system (CofActor)
[1]
Fusion protein: Cofilin; a actin-binding protein
Functional protein: Opto-a1AR
OS00012
OS Info
OS Name: CRY2-mCherry-LRP6c with N mutated PPAP motifs (CL6mN)
[2] , [3] , [4] , [5]
Fusion protein: Wnt coreceptor LRP6
OS00032
OS Info
OS Name: DCas9-based optical gene activation system (Opto-dCas9)
[6] , [7]
Recruited protein: CRISPR-associated endonuclease Cas9
Fusion protein: Transcription factor p65
OS00030
OS Info
OS Name: genetically encoded light-inducible protein-interaction system (LIPI)
[8]
Functional protein: Cryptochrome-2
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
OS00013
OS Info
OS Name: Light activated reversible inhibition by assembled trap (LARIAT)
[9] , [10] , [11]
Recruited protein: Multimeric protein
Fusion protein: Vav guanine nucleotide exchange factor 2
OS00047
OS Info
OS Name: Light activated rtTA system (Li-rtTA)
[12]
Recruited protein: Tetracycline repressor protein class D
Fusion protein: Virus protein 16
OS00034
OS Info
OS Name: Light induced PIP3 production system (PI3K)
[13]
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
Fusion protein: Inter-SH2 domain of p85beta
OS00029
OS Info
OS Name: Light inducible nuclear translocation and dimerization system (LINTAD)
[14]
Fusion protein: LexA activation domain
Recruited protein: Transcription regulator LexA
OS00018
OS Info
OS Name: Light-activated reversible inhibition by assembled trap of intracellular membranes by Rab11 (IM-LARIAT-Rab11)
[15]
Functional protein: Cryptochrome-2
Recruited protein: Ras-related protein Rab-11A
OS00017
OS Info
OS Name: Light-activated reversible inhibition by assembled trap of intracellular membranes by Rab5 (IM-LARIAT-Rab5)
[15]
Functional protein: Cryptochrome-2
Recruited protein: Ras-related protein Rab-5A
OS00657
OS Info
OS Name: Light-gated I-BAR (inverse BAR) domain containing tools 4 (CRYARs 4)
[16]
Recruited protein: CAAX prenyl protease?
Fusion protein: I-BAR (inverse BAR) domain (MTSS1(1-250))
OS00658
OS Info
OS Name: Light-gated I-BAR (inverse BAR) domain containing tools 5 (CRYARs 5)
[16]
Recruited protein: CAAX prenyl protease?
Fusion protein: I-BAR (inverse BAR) domain (MTSS1(1-250))
OS00659
OS Info
OS Name: Light-gated I-BAR (inverse BAR) domain containing tools 6 (CRYARs 6)
[16]
Recruited protein: CAAX prenyl protease?
Fusion protein: I-BAR (inverse BAR) domain (MTSS1(1-250))
OS00660
OS Info
OS Name: Light-gated I-BAR (inverse BAR) domain containing tools 7 (CRYARs 7)
[16]
Recruited protein: CAAX prenyl protease?
Fusion protein: Missing in Metastasis 1
OS00653
OS Info
OS Name: Light-inducible cell reprogramming system (LIRE)
[17]
Fusion protein: LexA activation domain
Recruited protein: Tetracycline repressor protein class D
OS00006
OS Info
OS Name: Light-inducible transcriptional effectors (LITEs)
[18]
Fusion protein: Transcription activator-like effectors
Recruited protein: Virus protein 16
OS00035
OS Info
OS Name: Light-trigggered recruitment of G protein signaling protein system (LTR-RGS)
[19]
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
Fusion protein: Regulator of G-protein signaling 4
OS00009
OS Info
OS Name: Optogenetic cofilin (OptoCofilin)
[20] , [21] , [22]
Recruited protein: A versatile marker
Fusion protein: Cofilin; a actin-binding protein
OS00041
OS Info
OS Name: Optogenetic control DDX4 system (OptoDDX4)
[23]
Fusion protein: Probable ATP-dependent RNA helicase DDX4
OS00622
OS Info
OS Name: Optogenetic control Exoc70 for membrane traffiking system 1 (Opto-Exoc70-MT 1)
[24]
Fusion protein: Exocyst complex component 70
OS00040
OS Info
OS Name: Optogenetic control FUS system (OptoFUS)
[23]
Fusion protein: RNA-binding protein FUS
OS00042
OS Info
OS Name: Optogenetic control HNRNPA1 system (OptoHNRNPA1)
[23]
Fusion protein: Heterogeneous nuclear ribonucleoprotein A1
OS00011
OS Info
OS Name: Optogenetic control of fibroblast growth factor receptor (OptoFGFR1)
[25] , [26]
Fusion protein: Fibroblast Growth Factor Receptor 1
OS00007
OS Info
OS Name: Optogenetic control of organelle transport system (Opto-cot)
[27] , [28]
Recruited protein: Protein bicaudal D homolog 2
Fusion protein: Transmembrane domain of Miro1
OS00044
OS Info
OS Name: Optogenetic control receptor molecules concentrate at the postsynaptic density system 1 (Opto-PSD 1)
[29]
Fusion protein: C-terminal of Homer protein homolog 1
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
OS00045
OS Info
OS Name: Optogenetic control receptor molecules concentrate at the postsynaptic density system 2 (Opto-PSD 2)
[29]
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
Fusion protein: Disks large homolog 4
OS00046
OS Info
OS Name: Optogenetic control receptor molecules concentrate at the postsynaptic density system 3 (Opto-PSD 3)
[29]
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
Fusion protein: Recombinant antibody-like proteins
OS00023
OS Info
OS Name: Optogenetic controlled Akt signal system (Opto-Akt)
[30]
Recruited protein: Membrane-targeting myristoylation sequence
Fusion protein: RAC-alpha serine/threonine-protein kinase
OS00024
OS Info
OS Name: Optogenetic controlled AKT1 signaling system (OptoAKT1)
[31] , [32]
Recruited protein: Myristoylation/palmitoylation signal HCK
Fusion protein: RAC-alpha serine/threonine-protein kinase
OS00028
OS Info
OS Name: Optogenetic controlled C-RAF signal system (Opto-C-RAF)
[33]
Recruited protein: Protein kinase CRAF
Fusion protein: RAF proto-oncogene serine/threonine-protein kinase
OS00016
OS Info
OS Name: Optogenetic controlled Dab1 signal system (Opto-Dab1)
[34]
Fusion protein: DAB adaptor protein 1
OS00048
OS Info
OS Name: Optogenetic controlled Focal Adhension Kinase (OptoFAK)
[35]
Fusion protein: Focal adhesion kinase
OS00027
OS Info
OS Name: Optogenetic controlled GEF signaling to regulate Ccd42 system (OptoGEF-Cdc42)
[36]
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
Fusion protein: Intersectin (ITSN) guanine exchange factor (GEF) catalytic domain
OS00019
OS Info
OS Name: Optogenetic controlled iTrkB signaling system1 (Opto-iTrkB1)
[37]
Fusion protein: Intracellular Tropomyosin receptor kinase B
OS00020
OS Info
OS Name: Optogenetic controlled iTrkB signaling system2 (Opto-iTrkB2)
[37]
Fusion protein: Intracellular Tropomyosin receptor kinase B
OS00021
OS Info
OS Name: Optogenetic controlled iTrkB signaling system3 (Opto-iTrkB3)
[37]
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
Fusion protein: Intracellular Tropomyosin receptor kinase B
OS00026
OS Info
OS Name: Optogenetic controlled Raf1 system (OptoRaf1)
[38] , [39]
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
Fusion protein: RAF proto-oncogene serine/threonine-protein kinase
OS00025
OS Info
OS Name: Optogenetic controlled Wnt signaling system (OptoWnt)
[40]
Fusion protein: Armadillo segment polarity protein
OS00628
OS Info
OS Name: Optogenetic dopamine transporter multimerization system (OptoDTM)
[41]
Fusion protein: Sodium-dependent dopamine transporter
OS00672
OS Info
OS Name: Optogenetic induction of caspase-8 mediated apoptosis V2 (Opto-Casp8-V2)
[42]
Fusion protein: Caspase-8
Recruited protein: Caspase-8
OS00673
OS Info
OS Name: Optogenetic induction of caspase-8 mediated apoptosis V2 cassette (Opto-Casp8-V2 cassette)
[42]
Fusion protein: Caspase-8
Recruited protein: Caspase-8
OS00629
OS Info
OS Name: Optogenetic mitochondira deformation system 1 (OptoMD 1)
[43]
Recruited protein: Kinesin heavy chain isoform 5A
Fusion protein: Transmembrane domain of Miro1
OS00624
OS Info
OS Name: Optogenetic multiple sclerosis mechanism researching system 1 (OptoMSMR 1)
[44]
Fusion protein: Heterogeneous ribonucleoprotein A1
OS00625
OS Info
OS Name: Optogenetic multiple sclerosis mechanism researching system 2 (OptoMSMR 2)
[44]
Fusion protein: Heterogeneous ribonucleoprotein A1
OS00626
OS Info
OS Name: Optogenetic multiple sclerosis mechanism researching system 3 (OptoMSMR 3)
[44]
Fusion protein: Heterogeneous ribonucleoprotein A1
OS00621
OS Info
OS Name: Optogenetic recruit talin for integrin activation system (OptoRTIA)
[45]
Fusion protein: Talin-1
OS00015
OS Info
OS Name: Optogenetic regulate DNA methylation system (Opto-DNAM)
[46]
Fusion protein: Human DNA methyltransferase 3A
Recruited protein: Telomere repeat binding factor-1
OS00049
OS Info
OS Name: Optogenetic regulate iTrkA activity by CRY2 system (Opto-iTrkA-CRY2)
[47]
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
Fusion protein: Tropomyosin receptor kinases A
OS00043
OS Info
OS Name: Optogenetic regulate RhoA activity by ARHGEF11 (OptoGEF-RhoA)
[48]
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
Fusion protein: RhoA activator
OS00039
OS Info
OS Name: Optogenetic regulate STE5 activity system (OptoSTE5)
[49]
Fusion protein: A single-pass transmembrane protein
Recruited protein: MAP kinase scaffold
OS00033
OS Info
OS Name: Optogenetic regulated 5-photolysase system (Opto-5-ptase)
[50] , [51]
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
Fusion protein: Inositol-polyphosphate-5-phosphatase OCRL
OS00010
OS Info
OS Name: Optogenetic regulated G-protein signaling system (Opto-RGS2)
[52]
Fusion protein: Human G-protein signaling 2
Recruited protein: Regulator of G-protein signaling 2
OS00036
OS Info
OS Name: Optogentic regulate stromal interaction molecule 1 system 1 (OptoSTIM1-1)
[53] , [54] , [55]
Fusion protein: Stromal interaction molecule 1
OS00037
OS Info
OS Name: Optogentic regulate stromal interaction molecule 1 system 3 (OptoSTIM1-3)
[56]
Functional protein: Cryptochrome-2
Recruited protein: Stromal interaction molecule 1
OS00038
OS Info
OS Name: Optogentic regulate stromal interaction molecule 1 system 4 (OptoSTIM1-4)
[56]
Fusion protein: Stromal interaction molecule 1
OS00031
OS Info
OS Name: Photoactivatable GAL promoter to control transcription system 2 (PA-GAL 2)
[]
Fusion protein: Regulatory protein GAL4
Recruited protein: Regulatory protein Gal4
OS00014
OS Info
OS Name: Photoactivated split lexA transcriptional activation system (PA-LexA)
[57]
Fusion protein: Transcription factor p65
OS00022
OS Info
OS Name: PIP3 production by photo-activated PI3K (PPAP1.0)
[58]
Recruited protein: Cryptochrome-interacting basic-helix-loop-helix 1
Fusion protein: Phosphoinositide 3-kinase regulatory subunit 6
References
1 CofActor: A light- and stress-gated optogenetic clustering tool to study disease-associated cytoskeletal dynamics in living cells
2 CL6mN: Rationally Designed Optogenetic Photoswitches with Tunable Dissociation Dynamics
3 Optogenetic protein clustering and signaling activation in mammalian cells
4 Optogenetic protein clustering through fluorescent protein tagging and extension of CRY2
5 Nucleation of the destruction complex on the centrosome accelerates degradation of -catenin and regulates Wnt signal transmission
6 CRISPR-Cas9-based photoactivatable transcription system
7 Spatiotemporal control of zebrafish (Danio rerio) gene expression using a light-activated CRISPR activation system
8 Rapid blue-light-mediated induction of protein interactions in living cells
9 Light-Induced Protein Clustering for Optogenetic Interference and Protein Interaction Analysis in Drosophila S2 Cells
10 Protein Inactivation by Optogenetic Trapping in Living Cells
11 Reversible protein inactivation by optogenetic trapping in cells
12 Optogenetic gene editing in regional skin
13 Optogenetic control of PIP3: PIP3 is sufficient to induce the actin-based active part of growth cones and is regulated via endocytosis
14 Engineering light-controllable CAR T cells for cancer immunotherapy
15 Optogenetic oligomerization of Rab GTPases regulates intracellular membrane trafficking
16 CRY-BARs: Versatile light-gated molecular tools for the remodeling of membrane architectures
17 An Optogenetic-Controlled Cell Reprogramming System for Driving Cell Fate and Light-Responsive Chimeric Mice
18 Optical control of mammalian endogenous transcription and epigenetic states
19 Subcellular optogenetic inhibition of G proteins generates signaling gradients and cell migration
20 Optogenetic perturbation of the biochemical pathways that control cell behavior
21 Optogenetic engineering: light-directed cell motility
22 Lifeact: a versatile marker to visualize F-actin
23 Spatiotemporal Control of Intracellular Phase Transitions Using Light-Activated optoDroplets
24 An active tethering mechanism controls the fate of vesicles
25 Aminoguanidine cream ameliorates skin tissue microenvironment in diabetic rats
26 Spatiotemporal control of fibroblast growth factor receptor signals by blue light
27 Optogenetic control of molecular motors and organelle distributions in cells
28 Light moves mountains in the cell
29 Optogenetic Control of Synaptic Composition and Function
30 An optogenetic system for interrogating the temporal dynamics of Akt
31 Multichromatic Control of Signaling Pathways in Mammalian Cells
32 Noncanonical role of Arabidopsis COP1/SPA complex in repressing BIN2-mediated PIF3 phosphorylation and degradation in darkness
33 Optogenetic control of protein kinase activity in mammalian cells
34 Optogenetic control of the Dab1 signaling pathway
35 Optogenetic control of focal adhesion kinase signaling
36 Predictive Spatiotemporal Manipulation of Signaling Perturbations Using Optogenetics
37 Optical Activation of TrkB Signaling
38 Reversible optogenetic control of kinase activity during differentiation and embryonic development
39 Light-mediated Reversible Modulation of the Mitogen-activated Protein Kinase Pathway during Cell Differentiation and Xenopus Embryonic Development
40 Coupling optogenetics and light-sheet microscopy, a method to study Wnt signaling during embryogenesis
41 Optogenetically-induced multimerization of the dopamine transporter increases uptake and trafficking to the plasma membrane
42 Optogenetic induction of caspase-8 mediated apoptosis by employing Arabidopsis cryptochrome 2
43 Light-inducible deformation of mitochondria in live cells
44 Multiple Sclerosis-Associated hnRNPA1 Mutations Alter hnRNPA1 Dynamics and Influence Stress Granule Formation
45 Optogenetics-based localization of talin to the plasma membrane promotes activation of 3 integrins
46 Optogenetic regulation of site-specific subtelomeric DNA methylation
47 Construction of Light-Activated Neurotrophin Receptors Using the Improved Light-Induced Dimerizer (iLID)
48 Optogenetic control of cellular forces and mechanotransduction
49 Benchmarking of optical dimerizer systems
50 Optogenetic control of phosphoinositide metabolism
51 Optogenetic inhibition of apical constriction during Drosophila embryonic development
52 Optogenetic Inhibition of G(q) Protein Signaling Reduces Calcium Oscillation Stochasticity
53 Optogenetic control of endogenous Ca(2+) channels in vivo
54 Visual quantification of prostaglandin E(2) discharge from a single cell
55 Calcium transients trigger switch-like discharge of prostaglandin E2in an extracellular signal-regulated kinase-dependent manner
56 Optogenetic engineering to probe the molecular choreography of STIM1-mediated cell signaling
57 Optogenetic Control of Gene Expression in Drosophila
58 Membrane Dynamics Induced by a Phosphatidylinositol 3,4,5-Trisphosphate Optogenetic Tool