General Information of This Controlled Protein (CP)
CP ID CP00331
CP Name C-terminal of Homer protein homolog 1 (HOMER1C)
CP Type Fusion protein
Common Name Homer protein homolog 1 (Homer-1)
Organism Homo sapiens (Human)
UniProt ID Q86YM7
UniProt Entry HOME1_HUMAN
KEGG hsa:9456
Function Postsynaptic density scaffolding protein. Binds and cross-links cytoplasmic regions of GRM1, GRM5, ITPR1, DNM3, RYR1, RYR2, SHANK1 and SHANK3. By physically linking GRM1 and GRM5 with ER-associated ITPR1 receptors, it aids the coupling of surface receptors to intracellular calcium release. May also couple GRM1 to PI3 kinase through its interaction with AGAP2. Isoform 1 regulates the trafficking and surface expression of GRM5. Isoform 3 acts as a natural dominant negative, in dynamic competition with constitutively expressed isoform 1 to regulate synaptic metabotropic glutamate function. Isoform 3, may be involved in the structural changes that occur at synapses during long-lasting neuronal plasticity and development. Forms a high-order complex with SHANK1, which in turn is necessary for the structural and functional integrity of dendritic spines (By similarity). Negatively regulates T cell activation by inhibiting the calcineurin-NFAT pathway. Acts by competing with calcineurin/PPP3CA for NFAT protein binding, hence preventing NFAT activation by PPP3CA.
Sequence
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS
Optogenetic System (OS) Controlling This CP
OS00044
OS Info
OS Name
Optogenetic control receptor molecules concentrate at the postsynaptic density system 1
[1]
Photoreceptor (PR) Name
Photolyase homology region of Arabidopsis Cryptochromes 2 (CRY2PHR)
PR Info
Components
Photoreceptor
Photolyase homology region of Arabidopsis Cryptochromes 2 (CRY2PHR)
Complementary Protein
Cryptochrome-interacting basic-helix-loop-helix 1 (CIB1/CIBN)
Cofactor
Flavin adenine dinucleotide (FAD)
References
1 Optogenetic Control of Synaptic Composition and Function