General Information of This Controlled Protein (CP)
CP ID CP00470
CP Name Ras-related protein Rab-11A (Rab11)
CP Type Recruited protein
Common Name Ras-related protein Rab-11A (Rab-11) (EC 3.6.5.2) (YL8)
Organism Homo sapiens (Human)
UniProt ID P62491
UniProt Entry RB11A_HUMAN
KEGG hsa:8766
Function The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The small Rab GTPase RAB11A regulates endocytic recycling. Acts as a major regulator of membrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B participates in CFTR trafficking to the plasma membrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma membrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral membranes. May also play a role in melanosome transport and release from melanocytes.
Sequence
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
Optogenetic System (OS) Controlling This CP
OS00018
OS Info
OS Name
Light-activated reversible inhibition by assembled trap of intracellular membranes by Rab11
[1]
Photoreceptor (PR) Name
Photolyase homology region of Arabidopsis Cryptochromes 2 (CRY2PHR)
PR Info
Components
Photoreceptor
Photolyase homology region of Arabidopsis Cryptochromes 2 (CRY2PHR)
Complementary Protein
Cryptochrome-interacting basic-helix-loop-helix 1 (CIB1/CIBN)
Cofactor
Flavin adenine dinucleotide (FAD)
References
1 Optogenetic oligomerization of Rab GTPases regulates intracellular membrane trafficking