Details of the Optogenetic Tool
| General Information of This Photoreceptor (PR) | ||||||
|---|---|---|---|---|---|---|
| PR ID | PR00082 | |||||
| PR Name | LOV2 domain of Avena sativa Phototropin 1 (AsLOV2) | |||||
| Source of Species | Avena sativa | |||||
| Class | LOV domain | |||||
| UniProt ID | O49003 | |||||
| GenBank | 162330142 | |||||
| PDB ID | 2V1A | |||||
| Sequence |
LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATV
RKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDA AEREGVMLIKKTAENIDEAAKEL |
|||||
| Components | Photoreceptor | LOV2 domain of Avena sativa Phototropin 1 (AsLOV2) | ||||
| Cofactor | Flavin mononucleotide (FMN) | |||||
| 3D Structure | ||||||
| Click to Save PDB File | ||||||
Cofactor Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Cofactor Name | Flavin mononucleotide (FMN) | |||||
| PubChem CID | 643976 | |||||
| Structure |
![]() |
|||||
| Formula | C17H21N4O9P | |||||
| Molecular Weight | 456.3 | |||||
| Optogenetic System (OS) Consisting of This PR |
|---|
OS Name: Blue light-inducible degradation domain (B-LID)
[1]
OS Name: Blue-lightCinduced K+ channel 1 (BLINK 1)
[2]
OS Name: Bue light-inducible nuclear export system (LEXY)
[3]
OS Name: Bue light-inducible nuclear export system 1 (LEXY 1)
[4]
OS Name: Bue light-inducible nuclear export system 2 (LEXY 2)
[4]
OS Name: Bue light-inducible nuclear export system 3 (LEXY 3)
[4]
OS Name: Bue light-inducible nuclear export system 4 (LEXY 4)
[4]
OS Name: Bue light-inducible nuclear import system (LINuS)
[3]
OS Name: Circularly permuted LOV inhibitor of protein synthesis 1 (CLIPS 1)
[5]
OS Name: Circularly permuted LOV inhibitor of protein synthesis 2 (CLIPS 2)
[5]
OS Name: Light-Controlled p21 Applying the LINuS System (LINuS)
[7]
OS Name: Light-inducible Cre recombinase (LiCre)
[8]
OS Name: Light-responsive RNA-protein nanowires (LRNA)
[9]
OS Name: LOV-Turbo precise spatiotemporal controling of proximity labeling (LOV-Turbo)
[10]
OS Name: MPP8-LAMS, MPP8-based light-activated modification sensor (MPP8-LAMS)
[11]
OS Name: Optogenetic control protein-protein interaction system 3 (Opto-PPI 3)
[13]
OS Name: Optogenetic control protein-protein interaction system 4 (Opto-PPI 4)
[13]
OS Name: Optogenetic JNK inhibit system 1 (OptoJNKi 1)
[14]
OS Name: Optogenetic modulation of REST target gene system 1 (Opto-REST 1)
[16]
OS Name: Optogenetic modulation of REST target gene system 2 (Opto-REST 2)
[16]
OS Name: Optogenetic p38MAPK inhibit system 1 (Optop38i 1)
[14]
OS Name: Optogenetic p38MAPK inhibit system 2 (Optop38i 2)
[14]
OS Name: Optogenetic p38MAPK inhibit system 3 (Optop38i 3)
[14]
OS Name: Optogenetic regulate SOAR function system (OptoSOAR)
[17]
OS Name: Optogenetic YAP S127A (optoYAP S127A)
[18] , []
OS Name: Photoactivatable targeted protein degradation system (paProtacL-Survivin)
[20]
| References |
|---|
Detail Info