General Information of This Controlled Protein (CP)
CP ID CP00372
CP Name Paired amphipathic helix 1 (PAH1)
CP Type Fusion protein
Common Name Paired amphipathic helix protein Sin3b (Histone deacetylase complex subunit Sin3b) (Transcriptional corepressor Sin3b)
Organism Mus musculus (Mouse)
UniProt ID Q62141
UniProt Entry SIN3B_MOUSE
KEGG mmu:20467
Function Acts as a transcriptional repressor. Interacts with MXI1 to repress MYC responsive genes and antagonize MYC oncogenic activities. Interacts with MAD-MAX heterodimers by binding to MAD. The heterodimer then represses transcription by tethering SIN3B to DNA. Also forms a complex with FOXK1 which represses transcription. With FOXK1, regulates cell cycle progression probably by repressing cell cycle inhibitor genes expression.
Sequence
PVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLI
VGFNAFLPLGYRIDIPK
Optogenetic System (OS) Controlling This CP
OS00168
OS Info
OS Name
Optogenetic modulation of REST target gene system 1
[1]
Photoreceptor (PR) Name
LOV2 domain of Avena sativa Phototropin 1 (AsLOV2)
PR Info
Components
Photoreceptor
LOV2 domain of Avena sativa Phototropin 1 (AsLOV2)
Cofactor
Flavin mononucleotide (FMN)
References
1 Regulation of neural gene transcription by optogenetic inhibition of the RE1-silencing transcription factor