General Information of This Controlled Protein (CP)
CP ID CP00536
CP Name H3K9me3-binding reader domain of the human M phase phosphoprotein 8 (MPP8)
CP Type Fusion protein
Common Name M-phase phosphoprotein 8
Organism Homo sapiens (Human)
UniProt ID Q99549
UniProt Entry MPP8_HUMAN
KEGG hsa:54737
Function Heterochromatin component that specifically recognizes and binds methylated 'Lys-9' of histone H3 (H3K9me) and promotes recruitment of proteins that mediate epigenetic repression. Mediates recruitment of the HUSH complex to H3K9me3 sites: the HUSH complex is recruited to genomic loci rich in H3K9me3 and is required to maintain transcriptional silencing by promoting recruitment of SETDB1, a histone methyltransferase that mediates further deposition of H3K9me3, as well as MORC2. Binds H3K9me and promotes DNA methylation by recruiting DNMT3A to target CpG sites; these can be situated within the coding region of the gene. Mediates down-regulation of CDH1 expression. Also represses L1 retrotransposons in collaboration with MORC2 and, probably, SETDB1, the silencing is dependent of repressive epigenetic modifications, such as H3K9me3 mark. Silencing events often occur within introns of transcriptionally active genes, and lead to the down-regulation of host gene expression. The HUSH complex is also involved in the silencing of unintegrated retroviral DNA by being recruited by ZNF638: some part of the retroviral DNA formed immediately after infection remains unintegrated in the host genome and is transcriptionally repressed.
Sequence
GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK
AKA
Optogenetic System (OS) Controlling This CP
OS00687
OS Info
OS Name
MPP8-LAMS, MPP8-based light-activated modification sensor
[1]
Photoreceptor (PR) Name
LOV2 domain of Avena sativa Phototropin 1 (AsLOV2)
PR Info
Components
Photoreceptor
LOV2 domain of Avena sativa Phototropin 1 (AsLOV2)
Cofactor
Flavin mononucleotide (FMN)
References
1 Optogenetics for sensors: On-demand fluorescent labeling of histone epigenetics