Details of the Controlled Protein | OPTICS

General Information of This Controlled Protein (CP)
CP ID	CP00409
CP Name	Zdark (Zdk)
CP Type	Recruited protein
Sequence	GSVDNKFNKEKTRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK

Optogenetic System (OS) Controlling This CP

OS00688

OS Name: Light-responsive RNA-protein nanowires; [1]
Photoreceptor (PR) Name: LOV2 domain of Avena sativa Phototropin 1 (AsLOV2); PR Info
Components: Photoreceptor; LOV2 domain of Avena sativa Phototropin 1 (AsLOV2)
: Cofactor; Flavin mononucleotide (FMN)

OS00228

OS Name: LOV2 trap and release of protein system; [2]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (LOVTRAP); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (LOVTRAP)
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00229

OS Name: Versatile method to control protein function by LOVTRAP system 1-1; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (LOVTRAP); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (LOVTRAP)
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00230

OS Name: Versatile method to control protein function by LOVTRAP system 1-2; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (LOVTRAP); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (LOVTRAP)
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00233

OS Name: Versatile method to control protein function by LOVTRAP system 2-1; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (I427T) (LOVTRAP (I427T) ); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (I427T) (LOVTRAP (I427T) )
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00234

OS Name: Versatile method to control protein function by LOVTRAP system 2-2; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (I427T) (LOVTRAP (I427T) ); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (I427T) (LOVTRAP (I427T) )
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00235

OS Name: Versatile method to control protein function by LOVTRAP system 3-1; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (V416T) (LOVTRAP (V416T) ); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (V416T) (LOVTRAP (V416T) )
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00236

OS Name: Versatile method to control protein function by LOVTRAP system 3-2; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (V416T) (LOVTRAP (V416T) ); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (V416T) (LOVTRAP (V416T) )
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00237

OS Name: Versatile method to control protein function by LOVTRAP system 4-1; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (I427V) (LOVTRAP (I427V) ); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (I427V) (LOVTRAP (I427V) )
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00238

OS Name: Versatile method to control protein function by LOVTRAP system 4-2; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (I427V) (LOVTRAP (I427V) ); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (I427V) (LOVTRAP (I427V) )
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00239

OS Name: Versatile method to control protein function by LOVTRAP system 5-1; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (V416I) (LOVTRAP (V416I) ); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (V416I) (LOVTRAP (V416I) )
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00240

OS Name: Versatile method to control protein function by LOVTRAP system 5-2; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (V416I) (LOVTRAP (V416I) ); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (V416I) (LOVTRAP (V416I) )
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00241

OS Name: Versatile method to control protein function by LOVTRAP system 6-1; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (V416L) (LOVTRAP (V416L) ); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (V416L) (LOVTRAP (V416L) )
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

OS00242

OS Name: Versatile method to control protein function by LOVTRAP system 6-2; [3]
Photoreceptor (PR) Name: LOV2 Trapping of Protein (V416L) (LOVTRAP (V416L) ); PR Info
Components: Photoreceptor; LOV2 Trapping of Protein (V416L) (LOVTRAP (V416L) )
: Complementary Protein; Zdark (ZDK)
: Cofactor; Flavin mononucleotide (FMN)

References

1	Engineer RNA-Protein Nanowires as Light-Responsive Biomaterials
2	Using Tools from Optogenetics to Create Light-Responsive Biomaterials: LOVTRAP-PEG Hydrogels for Dynamic Peptide Immobilization
3	LOVTRAP: A Versatile Method to Control Protein Function with Light