General Information of This Controlled Protein (CP)
CP ID CP00318
CP Name Girdin (GIV)
CP Type Fusion protein
Common Name Girdin (Akt phosphorylation enhancer) (APE) (Coiled-coil domain-containing protein 88A) (G alpha-interacting vesicle-associated protein) (GIV) (Girders of actin filament) (Hook-related protein 1) (HkRP1)
Organism Homo sapiens (Human)
UniProt ID Q3V6T2
UniProt Entry GRDN_HUMAN
KEGG hsa:55704
Function Bifunctional modulator of guanine nucleotide-binding proteins (G proteins). Acts as a non-receptor guanine nucleotide exchange factor which binds to and activates guanine nucleotide-binding protein G(i) alpha subunits. Also acts as a guanine nucleotide dissociation inhibitor for guanine nucleotide-binding protein G(s) subunit alpha GNAS. Essential for cell migration. Interacts in complex with G(i) alpha subunits with the EGFR receptor, retaining EGFR at the cell membrane following ligand stimulation and promoting EGFR signaling which triggers cell migration. Binding to Gi-alpha subunits displaces the beta and gamma subunits from the heterotrimeric G-protein complex which enhances phosphoinositide 3-kinase (PI3K)-dependent phosphorylation and kinase activity of AKT1/PKB. Phosphorylation of AKT1/PKB induces the phosphorylation of downstream effectors GSK3 and FOXO1/FKHR, and regulates DNA replication and cell proliferation (By similarity). Binds in its tyrosine-phosphorylated form to the phosphatidylinositol 3-kinase (PI3K) regulatory subunit PIK3R1 which enables recruitment of PIK3R1 to the EGFR receptor, enhancing PI3K activity and cell migration. Plays a role as a key modulator of the AKT-mTOR signaling pathway, controlling the tempo of the process of newborn neuron integration during adult neurogenesis, including correct neuron positioning, dendritic development and synapse formation (By similarity). Inhibition of G(s) subunit alpha GNAS leads to reduced cellular levels of cAMP and suppression of cell proliferation. Essential for the integrity of the actin cytoskeleton. Required for formation of actin stress fibers and lamellipodia. May be involved in membrane sorting in the early endosome. Plays a role in ciliogenesis and cilium morphology and positioning and this may partly be through regulation of the localization of scaffolding protein CROCC/Rootletin.
Sequence
KTGSPGSEVVTLQQFLEESNKLTSVQIKSSS
Optogenetic System (OS) Controlling This CP
OS00153
OS Info
OS Name
Control G-protein signal by LOV2 system
[1]
Photoreceptor (PR) Name
LOV2 domain of Avena sativa Phototropin 1 (AsLOV2)
PR Info
Components
Photoreceptor
LOV2 domain of Avena sativa Phototropin 1 (AsLOV2)
Cofactor
Flavin mononucleotide (FMN)
References
1 Optogenetic activation of heterotrimeric G-proteins by LOV2GIVe, a rationally engineered modular protein