Details of the Optogenetic Tool | OPTICS

General Information of This Photoreceptor (PR)
PR ID	PR00140
PR Name	Channelrhodopsin 2 (ChR2)
Source of Species	Chlamydomonas reinhardtii
Class	Opsin
UniProt ID	Q8RUT8
GenBank	1304111922
PDB ID	6EID
Sequence	MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAA GFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNPSMLYLATGHRVQWLR YAEWLLTCPVILIHLSNLTGLSNDYSRRTMGLLVSDIGTIVWGATSAMATGYVKVIFFCL GLCYGANTFFHAAKAYIEGYHTVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVL SVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIRKTTKLNIGGTEIEVETLV EDEAEAGAVNKGTGK
Components	Photoreceptor	Channelrhodopsin 2 (ChR2)
Components	Cofactor	All-trans-Retinal (Trans-Retinal)				Detail Info
3D Structure
3D Structure	Click to Save PDB File

Cofactor Detail of This PR
Cofactor Name	All-trans-Retinal (Trans-Retinal)
PubChem CID	638015
Structure
Formula	C20H28O
Molecular Weight	284.4

Optogenetic System (OS) Consisting of This PR

OS00302

OS Name: Design Channelrhodopsin 2 for ultrafast optogenetic control system 1 (ChR2-UOC 1)

[1]

Functional protein: Channelrhodopsin 2

OS00293

OS Name: EYFP tag Channelrhodopsin2 for neuron signal regulation system 1 (EYFP-ChR2-NSR 1)

[2] , [3] , [4] , [5]

Functional protein: Channelrhodopsin 2

OS00296

OS Name: MCh tag Channelrhodopsin2 for neuron signal regulation system 1 (MCh-ChR2-NSR 1)

[6] , [7]

Functional protein: Channelrhodopsin 2

OS00297

OS Name: MCh tag Channelrhodopsin2 for neuron signal regulation system 2 (MCh-ChR2-NSR 2)

[8] , [9]

Functional protein: Channelrhodopsin 2

OS00294

OS Name: Optogenetic activation brown adipose tissue for sympathetic neuromodulation 1 (Opto-BAT-SN1)

[10]

Functional protein: Channelrhodopsin 2

OS00734

OS Name: Optogenetic activation of axons system (Opto-axons)

[11]

Functional protein: Channelrhodopsin 2

OS00300

OS Name: Optogenetic neuromodulation for inflammation regulation system (Opto-NMF)

[12]

Functional protein: Channelrhodopsin 2

OS00301

OS Name: Optogenetic regulate cardiomyocytes system 1 (Opto-CM 1)

[13]

Functional protein: Channelrhodopsin 2

OS00299

OS Name: Optogenetic regulate postsynaptic potentials in the pharyngeal system (Opto-postP)

[14]

Functional protein: Channelrhodopsin 2

OS00298

OS Name: Optogenetic regulate retinal ganglion cell for vison form system (Opto-RGCs-VF)

[15]

Functional protein: Channelrhodopsin 2

OS00295

OS Name: Optogenetic regulation VTA dlutamate neuron system (Opto-VTA)

[16]

Functional protein: Channelrhodopsin 2

OS00610

OS Name: Optogenetic stimulate Vglut2-positive neurons for Parkinson's Disease treatment system (Opto-Vglut2-PD)

[17]

Functional protein: Channelrhodopsin 2

OS00707

OS Name: Optogenetic system of peripheral somatosensory neurons (Opto-PSN)

[18]

Functional protein: Channelrhodopsin 2

References

1	Ultrafast optogenetic control
2	Optogenetic control of insulin secretion by pancreatic -cells in vitro and in vivo
3	Median raphe serotonin neurons promote anxiety-like behavior via inputs to the dorsal hippocampus
4	Lost in translation: no effect of repeated optogenetic cortico-striatal stimulation on compulsivity in rats
5	Reorganization of Thalamic Inputs to Lesioned Cortex Following Experimental Traumatic Brain Injury
6	Neural substrates of awakening probed with optogenetic control of hypocretin neurons
7	Driving fast-spiking cells induces gamma rhythm and controls sensory responses
8	Optical deconstruction of parkinsonian neural circuitry
9	An optical neural interface: in vivo control of rodent motor cortex with integrated fiberoptic and optogenetic technology
10	Optogenetic-induced sympathetic neuromodulation of brown adipose tissue thermogenesis
11	A melanopsin ganglion cell subtype forms a dorsal retinal mosaic projecting to the supraoptic nucleus
12	Epineural optogenetic activation of nociceptors initiates and amplifies inflammation
13	Optogenetic modulation of cardiac action potential properties may prevent arrhythmogenesis in short and long QT syndromes
14	A comparison of electrically evoked and channel rhodopsin-evoked postsynaptic potentials in the pharyngeal system of Caenorhabditis elegans
15	Visual properties of transgenic rats harboring the channelrhodopsin-2 gene regulated by the thy-1.2 promoter
16	Combined In Vivo Anatomical and Functional Tracing of Ventral Tegmental Area Glutamate Terminals in the Hippocampus
17	Optogenetic stimulation of glutamatergic neurons in the cuneiform nucleus controls locomotion in a mouse model of Parkinson's disease
18	Optogenetic Activation of Peripheral Somatosensory Neurons in Transgenic Mice as a Neuropathic Pain Model for Assessing the Therapeutic Efficacy of Analgesics