Details of the Optogenetic Tool
General Information of This Photoreceptor (PR) | ||||||
---|---|---|---|---|---|---|
PR ID | PR00127 | |||||
PR Name | Erythrobacter litoralis 222 amino acid protein (EL222) | |||||
Source of Species | Erythrobacter litoralis | |||||
Class | LOV domain | |||||
UniProt ID | Q2NB98 | |||||
GenBank | 333944373 | |||||
PDB ID | 3P7N | |||||
Sequence |
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFTMGQDRPIDGSGAPGADDTRVEVQP
PAQWVLDLIEASPIASVVSDPRLADNPLIAINQAFTDLTGYSEEECVGRNCRFLAGSGTE PWLTDKIRQGVREHKPVLVEILNYKKDGTPFRNAVLVAPIYDDDDELLYFLGSQVEVDDD QPNMGMARRERAAEMLKTLSPRQLEVTTLVASGLRNKEVAARLGLSEKTVKMHRGLVMEK LNLKTSADLVRIAVEAGI |
|||||
Components | Photoreceptor | Erythrobacter litoralis 222 amino acid protein (EL222) | ||||
Cofactor | Flavin mononucleotide (FMN) | |||||
3D Structure | ||||||
Click to Save PDB File | ||||||
![]() |
||||||
---|---|---|---|---|---|---|
Cofactor Name | Flavin mononucleotide (FMN) | |||||
PubChem CID | 643976 | |||||
Structure |
![]() |
|||||
Formula | C17H21N4O9P | |||||
Molecular Weight | 456.3 | |||||
Optogenetic System (OS) Consisting of This PR |
---|
OS Name: Blue light inducible promoter (PBLind-v1)
[1]
OS Name: Light controlled exopolysaccharide expression system (LCEPSE)
[5]
OS Name: Light controlled sfGFP expression system (LCsfGFPE)
[5]
OS Name: Light-regulated stochastic transcriptional regulation system (LRSTR)
[6]
OS Name: Optogenetic CRISPR interference system (Opto-CRISPRi)
[7]
References |
---|