Details of the Optogenetic Tool
| General Information of This Photoreceptor (PR) | ||||||
|---|---|---|---|---|---|---|
| PR ID | PR00127 | |||||
| PR Name | Erythrobacter litoralis 222 amino acid protein (EL222) | |||||
| Source of Species | Erythrobacter litoralis | |||||
| Class | LOV domain | |||||
| UniProt ID | Q2NB98 | |||||
| GenBank | 333944373 | |||||
| PDB ID | 3P7N | |||||
| Sequence |
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFTMGQDRPIDGSGAPGADDTRVEVQP
PAQWVLDLIEASPIASVVSDPRLADNPLIAINQAFTDLTGYSEEECVGRNCRFLAGSGTE PWLTDKIRQGVREHKPVLVEILNYKKDGTPFRNAVLVAPIYDDDDELLYFLGSQVEVDDD QPNMGMARRERAAEMLKTLSPRQLEVTTLVASGLRNKEVAARLGLSEKTVKMHRGLVMEK LNLKTSADLVRIAVEAGI |
|||||
| Components | Photoreceptor | Erythrobacter litoralis 222 amino acid protein (EL222) | ||||
| Cofactor | Flavin mononucleotide (FMN) | |||||
| 3D Structure | ||||||
| Click to Save PDB File | ||||||
Cofactor Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Cofactor Name | Flavin mononucleotide (FMN) | |||||
| PubChem CID | 643976 | |||||
| Structure |
![]() |
|||||
| Formula | C17H21N4O9P | |||||
| Molecular Weight | 456.3 | |||||
| Optogenetic System (OS) Consisting of This PR |
|---|
OS Name: Blue light inducible promoter (PBLind-v1)
[1]
OS Name: Light controlled exopolysaccharide expression system (LCEPSE)
[5]
OS Name: Light controlled sfGFP expression system (LCsfGFPE)
[5]
OS Name: Light-regulated stochastic transcriptional regulation system (LRSTR)
[6]
OS Name: Optogenetic CRISPR interference system (Opto-CRISPRi)
[7]
| References |
|---|
Detail Info