Details of the Optogenetic Tool
| General Information of This Photoreceptor (PR) | ||||||
|---|---|---|---|---|---|---|
| PR ID | PR00081 | |||||
| PR Name | Vivid PAS domain (VVD) | |||||
| Source of Species | Neurospora crassa | |||||
| Class | LOV domain | |||||
| UniProt ID | Q9C3Y6 | |||||
| GenBank | 149243087 | |||||
| PDB ID | 2PDR | |||||
| Sequence |
MSHTVNSSTMNPWEVEAYQQYHYDPRTAPTANPLFFHTLYAPGGYDIMGYLIQIMNRPNP
QVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKP KSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMG FQCETE |
|||||
| Components | Photoreceptor | Vivid PAS domain (VVD) | ||||
| Cofactor | Flavin adenine dinucleotide (FAD) | |||||
| 3D Structure | ||||||
| Click to Save PDB File | ||||||
Cofactor Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Cofactor Name | Flavin adenine dinucleotide (FAD) | |||||
| PubChem CID | 643975 | |||||
| Structure |
![]() |
|||||
| Formula | C27H33N9O15P2 | |||||
| Molecular Weight | 785.5 | |||||
| Optogenetic System (OS) Consisting of This PR |
|---|
OS Name: Fungal lightCoxygenCvoltage system carrying Hap1p DBD (HAP-LOV)
[3]
OS Name: Optogenetic control gene expression by two LOV blue-light photoreceptor system (FUN-LOV)
[4]
OS Name: Optogenetic control Recombinase Cre by VVD system (Opto-Cre-VVD)
[5]
| References |
|---|
Detail Info