General Information of This Photoreceptor (PR)
PR ID PR00135
PR Name Negative Magnet (nMag)
Source of Species Neurospora crassa
Class LOV domain
Sequence
HTLYAPGGYDIMGYLDQIGNRPNPQVELGPVDTSCALILCDLKKDTPIVYASEAFLYMTC
RSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQ
RFVNFLTMIPVRDETGEYRYSMGFQCETE
Components Photoreceptor Negative Magnet (nMag)
Complementary Protein Positive Magnet (pMag)
Detail Info
Cofactor Flavin adenine dinucleotide (FAD)
Detail Info
3D Structure
Click to Save PDB File
Complementary Protein Detail of This PR
Complementary Protein Positive Magnet (pMag)
Sequence
HTLYAPGGYDIMGYLRQIRNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMT
GYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNG
QRFVNFLTMIPVRDETGEYRYSMGFQCETE
Cofactor Detail of This PR
Cofactor Name Flavin adenine dinucleotide (FAD)
PubChem CID 643975
Structure
Formula C27H33N9O15P2
Molecular Weight 785.5
Optogenetic System (OS) Consisting of This PR
OS00281
OS Info
OS Name: Enhanced Magnets system (EMags)
[1]
Functional protein: Negative Magnet
Recruited protein: Positive Magnet
OS00280
OS Info
OS Name: Optogenetic regulate Galpha activity system 2 (Opto-Galpha 2)
[2]
Recruited protein: Guanine nucleotide-binding protein G(q) subunit alpha
Functional protein: Negative Magnet
OS00279
OS Info
OS Name: Photoactivatable split-Cre recombinase optogenetic system (PA-Cre)
[3]
Fusion protein: CreN means N terminal of Cre recombinase and CreC means C terminal of Cre recombinase
Recruited protein: CreN means N terminal of Cre recombinase and CreC means C terminal of Cre recombinase
OS00699
OS Info
OS Name: Photoactivatable targeted gene editing system (paCas9-Survivin)
[4]
Functional protein: Negative Magnet
Recruited protein: Positive Magnet
OS00278
OS Info
OS Name: Tamoxifen-gated photoactivatable split-Cre recombinase optogenetic system (TamPA-Cre)
[5]
Fusion protein: CreN means N terminal of Cre recombinase and CreC means C terminal of Cre recombinase
Recruited protein: CreN means N terminal of Cre recombinase and CreC means C terminal of Cre recombinase
References
1 Optimized Vivid-derived Magnets photodimerizers for subcellular optogenetics in mammalian cells
2 Optical manipulation of the alpha subunits of heterotrimeric G proteins using photoswitchable dimerization systems
3 A photoactivatable Cre-loxP recombination system for optogenetic genome engineering
4 Split-Cas9-based targeted gene editing and nanobody-mediated proteolysis-targeting chimeras optogenetically coordinated regulation of Survivin to control the fate of cancer cells
5 An AND-Gated Drug and Photoactivatable Cre-loxP System for Spatiotemporal Control in Cell-Based Therapeutics