Details of the Controlled Protein
General Information of This Controlled Protein (CP) | ||||||
---|---|---|---|---|---|---|
CP ID | CP00430 | |||||
CP Name | Positive Magnet (pMag) | |||||
CP Type | Recruited protein | |||||
Sequence |
HTLYAPGGYDIMGYLRQIRNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMT
GYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNG QRFVNFLTMIPVRDETGEYRYSMGFQCETE |
|||||
Optogenetic System (OS) Controlling This CP |
---|
- OS Name
- Enhanced Magnets system
- [1]
- Photoreceptor (PR) Name
- Negative Magnet (nMag)
- Components
- Photoreceptor
- Negative Magnet (nMag)
- Complementary Protein
- Positive Magnet (pMag)
- Cofactor
- Flavin adenine dinucleotide (FAD)
- OS Name
- Photoactivatable targeted gene editing system
- [2]
- Photoreceptor (PR) Name
- Negative Magnet (nMag)
- Components
- Photoreceptor
- Negative Magnet (nMag)
- Complementary Protein
- Positive Magnet (pMag)
- Cofactor
- Flavin adenine dinucleotide (FAD)