Details of the Optogenetic Tool
General Information of This Photoreceptor (PR) | ||||||
---|---|---|---|---|---|---|
PR ID | PR00123 | |||||
PR Name | LOV2 Trapping of Protein (V416L) (LOVTRAP (V416L) ) | |||||
Source of Species | Avena sativa | |||||
Class | LOV domain | |||||
UniProt ID | O49003 | |||||
GenBank | 1047463129 | |||||
PDB ID | 5EFW | |||||
Mutation Site | V416L | |||||
Sequence |
LATTLERIEKNFLITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATV
RKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDA AEREGVMLIKKTAENIDEAAKEL |
|||||
Components | Photoreceptor | LOV2 Trapping of Protein (V416L) (LOVTRAP (V416L) ) | ||||
Complementary Protein | Zdark (ZDK) | |||||
Cofactor | Flavin mononucleotide (FMN) | |||||
3D Structure | ||||||
Click to Save PDB File | ||||||
Complementary Protein Detail of This PR | ||||||
---|---|---|---|---|---|---|
Complementary Protein | Zdark (ZDK) | |||||
Sequence |
GSVDNKFNKEKTRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK
|
|||||
Cofactor Detail of This PR | ||||||
---|---|---|---|---|---|---|
Cofactor Name | Flavin mononucleotide (FMN) | |||||
PubChem CID | 643976 | |||||
Structure | ||||||
Formula | C17H21N4O9P | |||||
Molecular Weight | 456.3 | |||||