Details of the Optogenetic Tool
| General Information of This Photoreceptor (PR) | ||||||
|---|---|---|---|---|---|---|
| PR ID | PR00118 | |||||
| PR Name | LOV2 Trapping of Protein (LOVTRAP) | |||||
| Source of Species | Avena sativa | |||||
| Class | LOV domain | |||||
| UniProt ID | O49003 | |||||
| GenBank | 1047463129 | |||||
| PDB ID | 5EFW | |||||
| Sequence |
LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATV
RKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDA AEREGVMLIKKTAENIDEAAKEL |
|||||
| Components | Photoreceptor | LOV2 Trapping of Protein (LOVTRAP) | ||||
| Complementary Protein | Zdark (ZDK) |
 Detail Info
|
||||
| Cofactor | Flavin mononucleotide (FMN) |
 Detail Info
|
||||
| 3D Structure | ||||||
| Click to Save PDB File | ||||||
| Complementary Protein Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Complementary Protein | Zdark (ZDK) | |||||
| Sequence |
GSVDNKFNKEKTRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK
|
|||||
| Cofactor Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Cofactor Name | Flavin mononucleotide (FMN) | |||||
| PubChem CID | 643976 | |||||
| Structure |
 |
|||||
| Formula | C17H21N4O9P | |||||
| Molecular Weight | 456.3 | |||||
| Optogenetic System (OS) Consisting of This PR |
|---|
OS Name: LOV2 trap and release of protein system (LOVTRAP)
[1]
OS Name: Optogenetic control alphaTAT activity by LOVTRAP system 1 (OptoalphaTAT-LOVTRAP 1)
OS Name: Versatile method to control protein function by LOVTRAP system 1-1 (LOVTRAP 1-1)
[4]
OS Name: Versatile method to control protein function by LOVTRAP system 1-2 (LOVTRAP 1-2)
[4]
| References |
|---|