Details of the Optogenetic Tool
General Information of This Photoreceptor (PR) | ||||||
---|---|---|---|---|---|---|
PR ID | PR00135 | |||||
PR Name | Negative Magnet (nMag) | |||||
Source of Species | Neurospora crassa | |||||
Class | LOV domain | |||||
Sequence |
HTLYAPGGYDIMGYLDQIGNRPNPQVELGPVDTSCALILCDLKKDTPIVYASEAFLYMTC
RSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQ RFVNFLTMIPVRDETGEYRYSMGFQCETE |
|||||
Components | Photoreceptor | Negative Magnet (nMag) | ||||
Complementary Protein | Positive Magnet (pMag) | |||||
Cofactor | Flavin adenine dinucleotide (FAD) | |||||
3D Structure | ||||||
Click to Save PDB File | ||||||
![]() |
||||||
---|---|---|---|---|---|---|
Complementary Protein | Positive Magnet (pMag) | |||||
Sequence |
HTLYAPGGYDIMGYLRQIRNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMT
GYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNG QRFVNFLTMIPVRDETGEYRYSMGFQCETE |
|||||
![]() |
||||||
---|---|---|---|---|---|---|
Cofactor Name | Flavin adenine dinucleotide (FAD) | |||||
PubChem CID | 643975 | |||||
Structure |
![]() |
|||||
Formula | C27H33N9O15P2 | |||||
Molecular Weight | 785.5 | |||||
Optogenetic System (OS) Consisting of This PR |
---|
OS Name: Enhanced Magnets system (EMags)
[1]
OS Name: Optogenetic regulate Galpha activity system 2 (Opto-Galpha 2)
[2]
OS Name: Photoactivatable split-Cre recombinase optogenetic system (PA-Cre)
[3]
Fusion protein: CreN means N terminal of Cre recombinase and CreC means C terminal of Cre recombinase
OS Name: Photoactivatable targeted gene editing system (paCas9-Survivin)
[4]
OS Name: Tamoxifen-gated photoactivatable split-Cre recombinase optogenetic system (TamPA-Cre)
[5]
Fusion protein: CreN means N terminal of Cre recombinase and CreC means C terminal of Cre recombinase
References |
---|