Details of the Optogenetic Tool
| General Information of This Photoreceptor (PR) | ||||||
|---|---|---|---|---|---|---|
| PR ID | PR00135 | |||||
| PR Name | Negative Magnet (nMag) | |||||
| Source of Species | Neurospora crassa | |||||
| Class | LOV domain | |||||
| Sequence |
HTLYAPGGYDIMGYLDQIGNRPNPQVELGPVDTSCALILCDLKKDTPIVYASEAFLYMTC
RSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQ RFVNFLTMIPVRDETGEYRYSMGFQCETE |
|||||
| Components | Photoreceptor | Negative Magnet (nMag) | ||||
| Complementary Protein | Positive Magnet (pMag) | |||||
| Cofactor | Flavin adenine dinucleotide (FAD) | |||||
| 3D Structure | ||||||
| Click to Save PDB File | ||||||
Complementary Protein Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Complementary Protein | Positive Magnet (pMag) | |||||
| Sequence |
HTLYAPGGYDIMGYLRQIRNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMT
GYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNG QRFVNFLTMIPVRDETGEYRYSMGFQCETE |
|||||
Cofactor Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Cofactor Name | Flavin adenine dinucleotide (FAD) | |||||
| PubChem CID | 643975 | |||||
| Structure |
![]() |
|||||
| Formula | C27H33N9O15P2 | |||||
| Molecular Weight | 785.5 | |||||
| Optogenetic System (OS) Consisting of This PR |
|---|
OS Name: Enhanced Magnets system (EMags)
[1]
OS Name: Optogenetic regulate Galpha activity system 2 (Opto-Galpha 2)
[2]
OS Name: Photoactivatable split-Cre recombinase optogenetic system (PA-Cre)
[3]
Fusion protein: CreN means N terminal of Cre recombinase and CreC means C terminal of Cre recombinase
OS Name: Photoactivatable targeted gene editing system (paCas9-Survivin)
[4]
OS Name: Tamoxifen-gated photoactivatable split-Cre recombinase optogenetic system (TamPA-Cre)
[5]
Fusion protein: CreN means N terminal of Cre recombinase and CreC means C terminal of Cre recombinase
| References |
|---|
Detail Info
Detail Info