Details of the Optogenetic Tool
General Information of This Photoreceptor (PR) | ||||||
---|---|---|---|---|---|---|
PR ID | PR00161 | |||||
PR Name | Improved Light-Inducible Dimer (iLID) | |||||
Source of Species | Avena sativa | |||||
Class | LOV domain | |||||
UniProt ID | O49003 | |||||
GenBank | 747155673 | |||||
PDB ID | 4WF0 | |||||
Sequence |
LATTLERIEKNFIITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATV
RKIRDAIDNQTEVTVQLINYTKSGKKFWNVFHLQPMRDYKGDVQYFIGVQLDGTERLHGA AEREAVCLIKKTAFQIAEAANDEYNF |
|||||
Components | Photoreceptor | Improved Light-Inducible Dimer (iLID) | ||||
Complementary Protein | Stringent starvation protein B (SspB (R73Q)) | |||||
Cofactor | Flavin mononucleotide (FMN) | |||||
3D Structure | ||||||
Click to Save PDB File | ||||||
Cofactor Detail of This PR | ||||||
---|---|---|---|---|---|---|
Cofactor Name | Flavin mononucleotide (FMN) | |||||
PubChem CID | 643976 | |||||
Structure | ||||||
Formula | C17H21N4O9P | |||||
Molecular Weight | 456.3 | |||||