General Information of This Controlled Protein (CP)
CP ID CP00451
CP Name Immunoreceptor tyrosine-based activation motifs (CD3zeta)
CP Type Recruited protein
Common Name T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)
Organism Homo sapiens (Human)
UniProt ID P20963
UniProt Entry CD3Z_HUMAN
KEGG hsa:919
Function Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN) (By similarity).
Sequence
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSAD
APAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMA
EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Optogenetic System (OS) Controlling This CP
OS00201
OS Info
OS Name
Optogenetic controlled CAR-T cell signal system
[1]
Photoreceptor (PR) Name
LOV2 domain of circular permutants (cpLOV2)
PR Info
Components
Photoreceptor
LOV2 domain of circular permutants (cpLOV2)
Complementary Protein
Engineered protein Zdk2 affibody (Zdk2)
Cofactor
Flavin mononucleotide (FMN)
References
1 Circularly permuted LOV2 as a modular photoswitch for optogenetic engineering