General Information of This Controlled Protein (CP)
CP ID CP00310
CP Name Ras-related C3 botulinum substrate1 (RAC1)
CP Type Fusion protein
Common Name Ras-related C3 botulinum toxin substrate 1 (EC 3.6.5.2) (Cell migration-inducing gene 5 protein) (Ras-like protein TC25) (p21-Rac1)
Organism Homo sapiens (Human)
UniProt ID P63000
UniProt Entry RAC1_HUMAN
KEGG hsa:5879
Function Plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization, neurons adhesion, migration and differentiation, and growth-factor induced formation of membrane ruffles. Rac1 p21/rho GDI heterodimer is the active component of the cytosolic factor sigma 1, which is involved in stimulation of the NADPH oxidase activity in macrophages. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. Stimulates PKN2 kinase activity. In concert with RAB7A, plays a role in regulating the formation of RBs (ruffled borders) in osteoclasts. In podocytes, promotes nuclear shuttling of NR3C2; this modulation is required for a proper kidney functioning. Required for atypical chemokine receptor ACKR2-induced LIMK1-PAK1-dependent phosphorylation of cofilin (CFL1) and for up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. In neurons, is involved in dendritic spine formation and synaptic plasticity (By similarity). In hippocampal neurons, involved in spine morphogenesis and synapse formation, through local activation at synapses by guanine nucleotide exchange factors (GEFs), such as ARHGEF6/ARHGEF7/PIX. In synapses, seems to mediate the regulation of F-actin cluster formation performed by SHANK3. In neurons, plays a crucial role in regulating GABA(A) receptor synaptic stability and hence GABAergic inhibitory synaptic transmission through its role in PAK1 activation and eventually F-actin stabilization (By similarity).
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
Optogenetic System (OS) Controlling This CP
OS00248
OS Info
OS Name
Optogenetic control Rac1 system
[1]
Photoreceptor (PR) Name
LOV4 domain from Botrytis cinerea (BcLOV4)
PR Info
Components
Photoreceptor
LOV4 domain from Botrytis cinerea (BcLOV4)
Cofactor
Flavin mononucleotide (FMN)
OS00173
OS Info
OS Name
Photo-activable Rac1 system 1
[2]
Photoreceptor (PR) Name
LOV2 domain of Avena sativa Phototropin 1 (C450A) (AsLOV2 (C450A))
PR Info
Components
Photoreceptor
LOV2 domain of Avena sativa Phototropin 1 (C450A) (AsLOV2 (C450A))
Cofactor
Flavin mononucleotide (FMN)
OS00175
OS Info
OS Name
Photo-activable Rac1 system 2
[2]
Photoreceptor (PR) Name
LOV2 domain of Avena sativa Phototropin 1 (I539E) (AsLOV2 (I539E))
PR Info
Components
Photoreceptor
LOV2 domain of Avena sativa Phototropin 1 (I539E) (AsLOV2 (I539E))
Cofactor
Flavin mononucleotide (FMN)
References
1 Optogenetic Rac1 engineered from membrane lipid-binding RGS-LOV for inducible lamellipodia formation
2 A genetically encoded photoactivatable Rac controls the motility of living cells