Details of the Optogenetic Tool
| General Information of This Photoreceptor (PR) | ||||||
|---|---|---|---|---|---|---|
| PR ID | PR00084 | |||||
| PR Name | LOV2 domain of Avena sativa Phototropin 1 (I539E) (AsLOV2 (I539E)) | |||||
| Source of Species | Avena sativa | |||||
| Class | LOV domain | |||||
| UniProt ID | O49003 | |||||
| GenBank | 162330142 | |||||
| PDB ID | 2V1A | |||||
| Mutation Site | I539E | |||||
| Sequence |
LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATV
RKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDA AEREGVMLIKKTAENEDEAAKEL |
|||||
| Components | Photoreceptor | LOV2 domain of Avena sativa Phototropin 1 (I539E) (AsLOV2 (I539E)) | ||||
| Cofactor | Flavin mononucleotide (FMN) |
 Detail Info
|
||||
| 3D Structure | ||||||
| Click to Save PDB File | ||||||
| Cofactor Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Cofactor Name | Flavin mononucleotide (FMN) | |||||
| PubChem CID | 643976 | |||||
| Structure |
 |
|||||
| Formula | C17H21N4O9P | |||||
| Molecular Weight | 456.3 | |||||