Details of the Controlled Protein
| General Information of This Controlled Protein (CP) | ||||||
|---|---|---|---|---|---|---|
| CP ID | CP00094 | |||||
| CP Name | LOV2 domain of circular permutants (cpLOV2) | |||||
| CP Type | Functional protein | |||||
| Sequence |
MTEHVRDAAEREGVMLIKKTAENIDEAAKELGGGSGGSGGGLATTLERIEKNFVITDPRL
PDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLIN YTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDG |
|||||
| Optogenetic System (OS) Controlling This CP |
|---|
- OS Name
- LOV2 domain of circular permutants for optogenetic engneering 1
- [1]
- Photoreceptor (PR) Name
- LOV2 domain of circular permutants (cpLOV2)
- Components
- Photoreceptor
- LOV2 domain of circular permutants (cpLOV2)
- Complementary Protein
- Engineered protein Zdk2 affibody (Zdk2)
- Cofactor
- Flavin mononucleotide (FMN)