Details of the Optogenetic Tool
General Information of This Photoreceptor (PR) | ||||||
---|---|---|---|---|---|---|
PR ID | PR00118 | |||||
PR Name | LOV2 Trapping of Protein (LOVTRAP) | |||||
Source of Species | Avena sativa | |||||
Class | LOV domain | |||||
UniProt ID | O49003 | |||||
GenBank | 1047463129 | |||||
PDB ID | 5EFW | |||||
Sequence |
LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATV
RKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDA AEREGVMLIKKTAENIDEAAKEL |
|||||
Components | Photoreceptor | LOV2 Trapping of Protein (LOVTRAP) | ||||
Complementary Protein | Zdark (ZDK) | |||||
Cofactor | Flavin mononucleotide (FMN) | |||||
3D Structure | ||||||
Click to Save PDB File | ||||||
![]() |
||||||
---|---|---|---|---|---|---|
Complementary Protein | Zdark (ZDK) | |||||
Sequence |
GSVDNKFNKEKTRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK
|
|||||
![]() |
||||||
---|---|---|---|---|---|---|
Cofactor Name | Flavin mononucleotide (FMN) | |||||
PubChem CID | 643976 | |||||
Structure |
![]() |
|||||
Formula | C17H21N4O9P | |||||
Molecular Weight | 456.3 | |||||
Optogenetic System (OS) Consisting of This PR |
---|
OS Name: LOV2 trap and release of protein system (LOVTRAP)
[1]
OS Name: Optogenetic control alphaTAT activity by LOVTRAP system 1 (OptoalphaTAT-LOVTRAP 1)
OS Name: Versatile method to control protein function by LOVTRAP system 1-1 (LOVTRAP 1-1)
[4]
OS Name: Versatile method to control protein function by LOVTRAP system 1-2 (LOVTRAP 1-2)
[4]
References |
---|