| General Information of This Controlled Protein (CP) |
| CP ID |
CP00287
|
| CP Name |
Cofilin; a actin-binding protein (Cof) |
| CP Type |
Fusion protein
|
| Common Name |
Cofilin-1 (18 kDa phosphoprotein) (p18) (Cofilin, non-muscle isoform)
|
| Organism |
Homo sapiens (Human)
|
| UniProt ID |
P23528
|
| UniProt Entry |
COF1_HUMAN
|
| KEGG |
hsa:1072
|
| Function |
Binds to F-actin and exhibits pH-sensitive F-actin depolymerizing activity. In conjunction with the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions via regulation of actin dynamics. Required for the centralization of the mitotic spindle and symmetric division of zygotes (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization in epithelial cells. Required for the up-regulation of atypical chemokine receptor ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. Required for neural tube morphogenesis and neural crest cell migration (By similarity).
|
| Sequence |
MAAGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASA KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
|
|
|
|
|
|
|
|