Details of the Optogenetic Tool
General Information of This Photoreceptor (PR) | ||||||
---|---|---|---|---|---|---|
PR ID | PR00124 | |||||
PR Name | LOV2 Trapping of Protein (C450A; L514K; G528A; L531E; N538E) (LOVTRAP (C450A; L514K; G528A; L531E; N538E)) | |||||
Source of Species | Avena sativa | |||||
Class | LOV domain | |||||
UniProt ID | O49003 | |||||
GenBank | 1047463129 | |||||
PDB ID | 5EFW | |||||
Mutation Site | C450A; L514K; G528A; L531E; N538E | |||||
Sequence |
LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATV
RKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQKDGTEHVRDA AEREAVMEIKKTAEEIDEAAKEL |
|||||
Components | Photoreceptor | LOV2 Trapping of Protein (C450A; L514K; G528A; L531E; N538E) (LOVTRAP (C450A; L514K; G528A; L531E; N538E)) | ||||
Complementary Protein | Zdark (ZDK) | |||||
Cofactor | Flavin mononucleotide (FMN) | |||||
3D Structure | ||||||
Click to Save PDB File | ||||||
Complementary Protein Detail of This PR | ||||||
---|---|---|---|---|---|---|
Complementary Protein | Zdark (ZDK) | |||||
Sequence |
GSVDNKFNKEKTRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK
|
|||||
Cofactor Detail of This PR | ||||||
---|---|---|---|---|---|---|
Cofactor Name | Flavin mononucleotide (FMN) | |||||
PubChem CID | 643976 | |||||
Structure | ||||||
Formula | C17H21N4O9P | |||||
Molecular Weight | 456.3 | |||||
Optogenetic System (OS) Consisting of This PR |
---|
OS Name: Optogenetic control alphaTAT activity by LOVTRAP system 2 (OptoalphaTAT-LOVTRAP 2)