Details of the Optogenetic Tool
General Information of This Photoreceptor (PR) | ||||||
---|---|---|---|---|---|---|
PR ID | PR00081 | |||||
PR Name | Vivid PAS domain (VVD) | |||||
Source of Species | Neurospora crassa | |||||
Class | LOV domain | |||||
UniProt ID | Q9C3Y6 | |||||
GenBank | 149243087 | |||||
PDB ID | 2PDR | |||||
Sequence |
MSHTVNSSTMNPWEVEAYQQYHYDPRTAPTANPLFFHTLYAPGGYDIMGYLIQIMNRPNP
QVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKP KSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMG FQCETE |
|||||
Components | Photoreceptor | Vivid PAS domain (VVD) | ||||
Cofactor | Flavin adenine dinucleotide (FAD) | |||||
3D Structure | ||||||
Click to Save PDB File | ||||||
Cofactor Detail of This PR | ||||||
---|---|---|---|---|---|---|
Cofactor Name | Flavin adenine dinucleotide (FAD) | |||||
PubChem CID | 643975 | |||||
Structure | ||||||
Formula | C27H33N9O15P2 | |||||
Molecular Weight | 785.5 | |||||
Optogenetic System (OS) Consisting of This PR |
---|
OS Name: Fungal lightCoxygenCvoltage system carrying Hap1p DBD (HAP-LOV)
[3]
OS Name: Optogenetic control gene expression by two LOV blue-light photoreceptor system (FUN-LOV)
[4]
OS Name: Optogenetic control Recombinase Cre by VVD system (Opto-Cre-VVD)
[5]
References |
---|