General Information of This Controlled Protein (CP)
CP ID CP00467
CP Name Exosome-associated tetraspanin protein CD9 (CD9)
CP Type Recruited protein
Common Name CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Organism Homo sapiens (Human)
UniProt ID P21926
UniProt Entry CD9_HUMAN
KEGG hsa:928
Function Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion (By similarity). In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration (By similarity). In macrophages, associates with CD81 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption (By similarity). Acts as a receptor for PSG17 (By similarity). Involved in platelet activation and aggregation. Regulates paranodal junction formation (By similarity). Involved in cell adhesion, cell motility and tumor metastasis.
Sequence
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV
YILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKE
VQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKS
CPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Optogenetic System (OS) Controlling This CP
OS00056
OS Info
OS Name
Exosomes for protein loading via optically reversible proteinCprotein interactions system
[1]
Photoreceptor (PR) Name
Cryptochrome 2 (CRY2)
PR Info
Components
Photoreceptor
Cryptochrome 2 (CRY2)
Complementary Protein
Cryptochrome-interacting basic-helix-loop-helix 1 (CIB1/CIBN)
Cofactor
Flavin adenine dinucleotide (FAD)
References
1 Exosome engineering for efficient intracellular delivery of soluble proteins using optically reversible protein-protein interaction module