Details of the Optogenetic Tool
| General Information of This Photoreceptor (PR) | ||||||
|---|---|---|---|---|---|---|
| PR ID | PR00354 | |||||
| PR Name | Cobalamin-binding domain from Thermus thermophilus (TtCBD) | |||||
| Source of Species | Thermus thermophilus | |||||
| Class | Cobalamin binding domain | |||||
| Sequence |
PEDLGTGLLEALLRGDLAGAEALFRRGLRFWGPEGILEHLLLPVLREVGEAWHRGEIGVA
EEHLASTFLRARLQELLDLAGFPPGPPVLVTTPPGERHEIGAMLAAYHLRRKGVPALYLG PDTPLPDLRALARRLGAGAVVLSALLSEPLRALPDGALKDLAPRVFLGGQGAGPEEARRL GAEYMEDLKGLAEALWLPRGPEKEAI |
|||||
| Components | Photoreceptor | Cobalamin-binding domain from Thermus thermophilus (TtCBD) | ||||
| Cofactor | 5-deoxyadenosylcobalamin (AdoCbl) |
 Detail Info
|
||||
| 3D Structure | ||||||
| Click to Save PDB File | ||||||
| Cofactor Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Cofactor Name | 5-deoxyadenosylcobalamin (AdoCbl) | |||||
| PubChem CID | 135846129 | |||||
| Formula | C72H101CoN18O17P+ | |||||
| Molecular Weight | 1580.6 | |||||
| Optogenetic System (OS) Consisting of This PR |
|---|
OS Name: Optogenetic control gene expression by green light (OptoGE-GL)
[1]