Details of the Optogenetic Tool
General Information of This Photoreceptor (PR) | ||||||
---|---|---|---|---|---|---|
PR ID | PR00095 | |||||
PR Name | LOV2 domain of circular permutants (I539E) (cpLOV2 (I539E)) | |||||
Source of Species | Circularly permuted from LOV2 | |||||
Class | LOV domain | |||||
Mutation Site | I539E | |||||
Sequence |
MTEHVRDAAEREGVMLIKKTAENEDEAAKELGGGSGGSGGGLATTLERIEKNFVITDPRL
PDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLIN YTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDG |
|||||
Components | Photoreceptor | LOV2 domain of circular permutants (I539E) (cpLOV2 (I539E)) | ||||
Complementary Protein | Stringent starvation protein B (SspB) | |||||
Cofactor | Flavin mononucleotide (FMN) | |||||
3D Structure | ||||||
Click to Save PDB File | ||||||
![]() |
||||||
---|---|---|---|---|---|---|
Cofactor Name | Flavin mononucleotide (FMN) | |||||
PubChem CID | 643976 | |||||
Structure |
![]() |
|||||
Formula | C17H21N4O9P | |||||
Molecular Weight | 456.3 | |||||
Optogenetic System (OS) Consisting of This PR |
---|
OS Name: Optical dimerizar ssrA-cpLOV2 (CpLID)
[1]