Details of the Optogenetic Tool
| General Information of This Photoreceptor (PR) | ||||||
|---|---|---|---|---|---|---|
| PR ID | PR00094 | |||||
| PR Name | LOV2 domain of circular permutants (I427V) (cpLOV2 (I427V)) | |||||
| Source of Species | Circularly permuted from LOV2 | |||||
| Class | LOV domain | |||||
| Mutation Site | I427V | |||||
| Sequence |
MTEHVRDAAEREGVMLIKKTAENIDEAAKELGGGSGGSGGGLATTLERIEKNFVITDPRL
PDNPVIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLIN YTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDG |
|||||
| Components | Photoreceptor | LOV2 domain of circular permutants (I427V) (cpLOV2 (I427V)) | ||||
| Complementary Protein | Engineered protein Zdk2 affibody (Zdk2) | |||||
| Cofactor | Flavin mononucleotide (FMN) | |||||
| 3D Structure | ||||||
| Click to Save PDB File | ||||||
Complementary Protein Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Complementary Protein | Engineered protein Zdk2 affibody (Zdk2) | |||||
| Sequence |
GGSVDNKFNKEMLSARVEIYGLPNLNWGQRFAFISSLTDDPSQSANLLAEAKKLNDAQAP
K |
|||||
Cofactor Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Cofactor Name | Flavin mononucleotide (FMN) | |||||
| PubChem CID | 643976 | |||||
| Structure |
![]() |
|||||
| Formula | C17H21N4O9P | |||||
| Molecular Weight | 456.3 | |||||
| Optogenetic System (OS) Consisting of This PR |
|---|
OS Name: LOV2 domain of circular permutants for optogenetic engneering 3 (CPLOV2-3)
[1]
Detail Info
Detail Info