Details of the Controlled Protein
| General Information of This Controlled Protein (CP) | ||||||
|---|---|---|---|---|---|---|
| CP ID | CP00096 | |||||
| CP Name | LOV2 domain of circular permutants (cpLOV2) | |||||
| CP Type | Functional protein | |||||
| Sequence |
MTEHVRDAAEREGVMLIKKTAENIDEAAKELGGGSGGSGGGLATTLERIEKNFVITDPRL
PDNPVIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLIN YTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDG |
|||||
| Optogenetic System (OS) Controlling This CP |
|---|
- OS Name
- LOV2 domain of circular permutants for optogenetic engneering 3
- [1]
- Photoreceptor (PR) Name
- LOV2 domain of circular permutants (I427V) (cpLOV2 (I427V))
- Components
- Photoreceptor
- LOV2 domain of circular permutants (I427V) (cpLOV2 (I427V))
- Complementary Protein
- Engineered protein Zdk2 affibody (Zdk2)
- Cofactor
- Flavin mononucleotide (FMN)