Details of the Optogenetic Tool
General Information of This Photoreceptor (PR) | ||||||
---|---|---|---|---|---|---|
PR ID | PR00084 | |||||
PR Name | LOV2 domain of Avena sativa Phototropin 1 (I539E) (AsLOV2 (I539E)) | |||||
Source of Species | Avena sativa | |||||
Class | LOV domain | |||||
UniProt ID | O49003 | |||||
GenBank | 162330142 | |||||
PDB ID | 2V1A | |||||
Mutation Site | I539E | |||||
Sequence |
LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATV
RKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDA AEREGVMLIKKTAENEDEAAKEL |
|||||
Components | Photoreceptor | LOV2 domain of Avena sativa Phototropin 1 (I539E) (AsLOV2 (I539E)) | ||||
Cofactor | Flavin mononucleotide (FMN) | |||||
3D Structure | ||||||
Click to Save PDB File | ||||||
![]() |
||||||
---|---|---|---|---|---|---|
Cofactor Name | Flavin mononucleotide (FMN) | |||||
PubChem CID | 643976 | |||||
Structure |
![]() |
|||||
Formula | C17H21N4O9P | |||||
Molecular Weight | 456.3 | |||||