Details of the Optogenetic System
| General Information of This Optogenetic System (OS) | ||||||
|---|---|---|---|---|---|---|
| OS ID |
OS00303
|
|||||
| OS Application Information (1) | ||||||
|---|---|---|---|---|---|---|
| Mechanism of Action | Ion channel open | [ 1] | ||||
| Controlled Signal Pathway | Bidirectional current to regulate neuron activity | |||||
| Effect | Sensor | |||||
| Application | Bi-directional control the voltage of individual neurons to control cell signal | |||||
| Note | 2A peptide sequence:KKQKIVAPVKQTLNFDLLKLAGDVESNPGP | |||||
| Current Intensity | 157 ± 63 pA (ChR2) | |||||
| Channel Type | Cation channel (ChR2); Anion channel (NpHR) | |||||
| Light Information | Activation Wavelength | 470 ± 20 nm (ChR2) | ||||
| Deactivation Wavelength | 575 ± 25 nm (NpHR) | |||||
| Activation Time | 0.25 s | |||||
| Deactivation Time | 0.25 s | |||||
| Light Intensity | 10 milliwatts per square miliimeter | |||||
| Expression Information | Expression Method | Transfection | ||||
| Cell Lines | Mouse hippocampal neurons | |||||
| OS Application Information (2) | ||||||
|---|---|---|---|---|---|---|
| Mechanism of Action | Ion channel open | [ 1] | ||||
| Controlled Signal Pathway | Bidirectional current to regulate neuron activity | |||||
| Effect | Sensor | |||||
| Application | Bi-directional control the voltage of individual neurons to control cell signal | |||||
| Note | 2A peptide sequence:KKQKIVAPVKQTLNFDLLKLAGDVESNPGP | |||||
| Current Intensity | 40 ± 24 pA (NpHR) | |||||
| Channel Type | Cation channel (ChR2); Anion channel (NpHR) | |||||
| Light Information | Activation Wavelength | 470 ± 20 nm (ChR2) | ||||
| Deactivation Wavelength | 575 ± 25 nm (NpHR) | |||||
| Activation Time | 0.25 s | |||||
| Deactivation Time | 0.25 s | |||||
| Light Intensity | 10 milliwatts per square miliimeter | |||||
| Expression Information | Expression Method | Transfection | ||||
| Cell Lines | Mouse hippocampal neurons | |||||