Details of the Optogenetic Tool
| General Information of This Photoreceptor (PR) | ||||||
|---|---|---|---|---|---|---|
| PR ID | PR00123 | |||||
| PR Name | LOV2 Trapping of Protein (V416L) (LOVTRAP (V416L) ) | |||||
| Source of Species | Avena sativa | |||||
| Class | LOV domain | |||||
| UniProt ID | O49003 | |||||
| GenBank | 1047463129 | |||||
| PDB ID | 5EFW | |||||
| Mutation Site | V416L | |||||
| Sequence |
LATTLERIEKNFLITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATV
RKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDA AEREGVMLIKKTAENIDEAAKEL |
|||||
| Components | Photoreceptor | LOV2 Trapping of Protein (V416L) (LOVTRAP (V416L) ) | ||||
| Complementary Protein | Zdark (ZDK) | |||||
| Cofactor | Flavin mononucleotide (FMN) | |||||
| 3D Structure | ||||||
| Click to Save PDB File | ||||||
Complementary Protein Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Complementary Protein | Zdark (ZDK) | |||||
| Sequence |
GSVDNKFNKEKTRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK
|
|||||
Cofactor Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Cofactor Name | Flavin mononucleotide (FMN) | |||||
| PubChem CID | 643976 | |||||
| Structure |
![]() |
|||||
| Formula | C17H21N4O9P | |||||
| Molecular Weight | 456.3 | |||||
Detail Info
Detail Info