Details of the Optogenetic Tool
General Information of This Photoreceptor (PR) | ||||||
---|---|---|---|---|---|---|
PR ID | PR00093 | |||||
PR Name | LOV2 domain of circular permutants (Q513L) (cpLOV2 (Q513L)) | |||||
Source of Species | Circularly permuted from LOV2 | |||||
Class | LOV domain | |||||
Mutation Site | Q513L | |||||
Sequence |
MTEHVRDAAEREGVMLIKKTAENIDEAAKELGGGSGGSGGGLATTLERIEKNFVITDPRL
PDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLIN YTKSGKKFWNLFHLQPMRDQKGDVQYFIGVLLDG |
|||||
Components | Photoreceptor | LOV2 domain of circular permutants (Q513L) (cpLOV2 (Q513L)) | ||||
Complementary Protein | Engineered protein Zdk2 affibody (Zdk2) | |||||
Cofactor | Flavin mononucleotide (FMN) | |||||
3D Structure | ||||||
Click to Save PDB File | ||||||
![]() |
||||||
---|---|---|---|---|---|---|
Complementary Protein | Engineered protein Zdk2 affibody (Zdk2) | |||||
Sequence |
GGSVDNKFNKEMLSARVEIYGLPNLNWGQRFAFISSLTDDPSQSANLLAEAKKLNDAQAP
K |
|||||
![]() |
||||||
---|---|---|---|---|---|---|
Cofactor Name | Flavin mononucleotide (FMN) | |||||
PubChem CID | 643976 | |||||
Structure |
![]() |
|||||
Formula | C17H21N4O9P | |||||
Molecular Weight | 456.3 | |||||
Optogenetic System (OS) Consisting of This PR |
---|
OS Name: LOV2 domain of circular permutants for optogenetic engneering 2 (CPLOV2-2)
[1]