Details of the Optogenetic Tool
| General Information of This Photoreceptor (PR) | ||||||
|---|---|---|---|---|---|---|
| PR ID | PR00092 | |||||
| PR Name | LOV2 domain of circular permutants (cpLOV2) | |||||
| Source of Species | Circularly permuted from LOV2 | |||||
| Class | LOV domain | |||||
| Sequence |
MTEHVRDAAEREGVMLIKKTAENIDEAAKELGGGSGGSGGGLATTLERIEKNFVITDPRL
PDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLIN YTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDG |
|||||
| Components | Photoreceptor | LOV2 domain of circular permutants (cpLOV2) | ||||
| Complementary Protein | Engineered protein Zdk2 affibody (Zdk2) |
 Detail Info
|
||||
| Cofactor | Flavin mononucleotide (FMN) |
 Detail Info
|
||||
| 3D Structure | ||||||
| Click to Save PDB File | ||||||
| Complementary Protein Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Complementary Protein | Engineered protein Zdk2 affibody (Zdk2) | |||||
| Sequence |
GGSVDNKFNKEMLSARVEIYGLPNLNWGQRFAFISSLTDDPSQSANLLAEAKKLNDAQAP
K |
|||||
| Cofactor Detail of This PR |
||||||
|---|---|---|---|---|---|---|
| Cofactor Name | Flavin mononucleotide (FMN) | |||||
| PubChem CID | 643976 | |||||
| Structure |
 |
|||||
| Formula | C17H21N4O9P | |||||
| Molecular Weight | 456.3 | |||||