Details of the Controlled Protein
| General Information of This Controlled Protein (CP) | ||||||
|---|---|---|---|---|---|---|
| CP ID | CP00366 | |||||
| CP Name | GCN4 leucine zipper (LZ) | |||||
| CP Type | Fusion protein | |||||
| Sequence |
RMKQLEDKVEELLSKNYHLENEVARLKKLVGER
|
|||||
| Optogenetic System (OS) Controlling This CP |
|---|
- OS Name
- Optogenetic recuit factors to microtubule plus ends system 2
- [1]
- Photoreceptor (PR) Name
- Improved Light-Inducible Dimer (iLID)
- Components
- Photoreceptor
- Improved Light-Inducible Dimer (iLID)
- Complementary Protein
- Stringent starvation protein B (SspB)
- Cofactor
- Flavin mononucleotide (FMN)